DEPDC7 purified MaxPab rabbit polyclonal antibody (D01P) View larger

DEPDC7 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DEPDC7 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about DEPDC7 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00091614-D01P
Product name: DEPDC7 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human DEPDC7 protein.
Gene id: 91614
Gene name: DEPDC7
Gene alias: TR2|dJ85M6.4
Gene description: DEP domain containing 7
Genbank accession: BC030970
Immunogen: DEPDC7 (AAH30970.1, 1 a.a. ~ 511 a.a) full-length human protein.
Immunogen sequence/protein sequence: MATVQEKAAALNLSALHSPAHRPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHRLKRHNDCFVGSEAVDVIFSHLIQNKYFGDVDIPRAKVVRVCQALMDYKVFEAVPTKVFGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSSNYLDRGILKAYSDSQEDEWLSAAIDCLEYLPDQMVVEISRSFPEQPDRTDLVKELLFDAIGRYYSSREPLLNHLSDVHNGIAELLVNGKTEIALEATQLLLKLLDFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNIEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD
Protein accession: AAH30970.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00091614-D01P-13-15-1.jpg
Application image note: Western Blot analysis of DEPDC7 expression in transfected 293T cell line (H00091614-T02) by DEPDC7 MaxPab polyclonal antibody.

Lane 1: DEPDC7 transfected lysate(58.30 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DEPDC7 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart