COL23A1 monoclonal antibody (M01A), clone 2C9 View larger

COL23A1 monoclonal antibody (M01A), clone 2C9

H00091522-M01A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COL23A1 monoclonal antibody (M01A), clone 2C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about COL23A1 monoclonal antibody (M01A), clone 2C9

Brand: Abnova
Reference: H00091522-M01A
Product name: COL23A1 monoclonal antibody (M01A), clone 2C9
Product description: Mouse monoclonal antibody raised against a partial recombinant COL23A1.
Clone: 2C9
Isotype: IgG2a Kappa
Gene id: 91522
Gene name: COL23A1
Gene alias: DKFZp434K0621
Gene description: collagen, type XXIII, alpha 1
Genbank accession: NM_173465
Immunogen: COL23A1 (NP_775736, 338 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KGELGLPGAPGIDGEKGPKGQKGDPGEPGPAGLKGEAGEMGLSGLPGADGLKGEKGESASDSLQESLAQLIVE
Protein accession: NP_775736
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00091522-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy COL23A1 monoclonal antibody (M01A), clone 2C9 now

Add to cart