BTF3L4 MaxPab mouse polyclonal antibody (B01) View larger

BTF3L4 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BTF3L4 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about BTF3L4 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00091408-B01
Product name: BTF3L4 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human BTF3L4 protein.
Gene id: 91408
Gene name: BTF3L4
Gene alias: MGC23908|MGC88389|RP4-800M22.5
Gene description: basic transcription factor 3-like 4
Genbank accession: NM_152265
Immunogen: BTF3L4 (NP_689478.1, 1 a.a. ~ 158 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN
Protein accession: NP_689478.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00091408-B01-13-15-1.jpg
Application image note: Western Blot analysis of BTF3L4 expression in transfected 293T cell line (H00091408-T01) by BTF3L4 MaxPab polyclonal antibody.

Lane 1: BTF3L4 transfected lysate(17.38 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BTF3L4 MaxPab mouse polyclonal antibody (B01) now

Add to cart