DKFZp434B1231 monoclonal antibody (M01), clone 5B12 View larger

DKFZp434B1231 monoclonal antibody (M01), clone 5B12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DKFZp434B1231 monoclonal antibody (M01), clone 5B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about DKFZp434B1231 monoclonal antibody (M01), clone 5B12

Brand: Abnova
Reference: H00091156-M01
Product name: DKFZp434B1231 monoclonal antibody (M01), clone 5B12
Product description: Mouse monoclonal antibody raised against a partial recombinant DKFZp434B1231.
Clone: 5B12
Isotype: IgG2a Kappa
Gene id: 91156
Gene name: IGFN1
Gene alias: DKFZp434B1231|EEF1A2BP1
Gene description: immunoglobulin-like and fibronectin type III domain containing 1
Genbank accession: NM_178275
Immunogen: DKFZp434B1231 (NP_840059, 720 a.a. ~ 818 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP
Protein accession: NP_840059
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00091156-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00091156-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to DKFZp434B1231 on HeLa cell. [antibody concentration 15 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DKFZp434B1231 monoclonal antibody (M01), clone 5B12 now

Add to cart