Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DKFZp434B1231 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about DKFZp434B1231 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00091156-A01 |
| Product name: | DKFZp434B1231 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DKFZp434B1231. |
| Gene id: | 91156 |
| Gene name: | IGFN1 |
| Gene alias: | DKFZp434B1231|EEF1A2BP1 |
| Gene description: | immunoglobulin-like and fibronectin type III domain containing 1 |
| Genbank accession: | NM_178275 |
| Immunogen: | DKFZp434B1231 (NP_840059, 720 a.a. ~ 818 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP |
| Protein accession: | NP_840059 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DKFZp434B1231 polyclonal antibody (A01), Lot # 051024JC01 Western Blot analysis of DKFZp434B1231 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of Molecular Tumor Markers in Renal Cell Carcinomas with TFE3 Protein Expression by RNA Sequencing.Pflueger D, Sboner A, Storz M, Roth J, Comp廨at E, Bruder E, Rubin MA, Schraml P, Moch H. Neoplasia. 2013 Nov;15(11):1231-40. |