ESAM monoclonal antibody (M03), clone 1G8 View larger

ESAM monoclonal antibody (M03), clone 1G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ESAM monoclonal antibody (M03), clone 1G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ESAM monoclonal antibody (M03), clone 1G8

Brand: Abnova
Reference: H00090952-M03
Product name: ESAM monoclonal antibody (M03), clone 1G8
Product description: Mouse monoclonal antibody raised against a full-length recombinant ESAM.
Clone: 1G8
Isotype: IgG2a Kappa
Gene id: 90952
Gene name: ESAM
Gene alias: W117m
Gene description: endothelial cell adhesion molecule
Genbank accession: BC016868
Immunogen: ESAM (AAH16868, 1 a.a. ~ 390 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV
Protein accession: AAH16868
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00090952-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ESAM is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ESAM monoclonal antibody (M03), clone 1G8 now

Add to cart