ESAM purified MaxPab mouse polyclonal antibody (B01P) View larger

ESAM purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ESAM purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ESAM purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00090952-B01P
Product name: ESAM purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ESAM protein.
Gene id: 90952
Gene name: ESAM
Gene alias: W117m
Gene description: endothelial cell adhesion molecule
Genbank accession: BC016868.1
Immunogen: ESAM (AAH16868.1, 1 a.a. ~ 390 a.a) full-length human protein.
Immunogen sequence/protein sequence: MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV
Protein accession: AAH16868.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00090952-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ESAM expression in transfected 293T cell line (H00090952-T02) by ESAM MaxPab polyclonal antibody.

Lane 1: ESAM transfected lysate(41.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ESAM purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart