Brand: | Abnova |
Reference: | H00090865-M01 |
Product name: | IL33 monoclonal antibody (M01), clone 2D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IL33. |
Clone: | 2D8 |
Isotype: | IgG2a Kappa |
Gene id: | 90865 |
Gene name: | IL33 |
Gene alias: | C9orf26|DKFZp586H0523|DVS27|NF-HEV|NFEHEV|RP11-575C20.2 |
Gene description: | interleukin 33 |
Genbank accession: | NM_033439 |
Immunogen: | IL33 (NP_254274.1, 171 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSE |
Protein accession: | NP_254274.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | IL33 monoclonal antibody (M01), clone 2D8. Western Blot analysis of IL33 expression in human stomach. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |