Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00090861-B01 |
Product name: | HN1L MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human HN1L protein. |
Gene id: | 90861 |
Gene name: | HN1L |
Gene alias: | C16orf34|FLJ13092|KIAA1426|L11 |
Gene description: | hematological and neurological expressed 1-like |
Genbank accession: | NM_144570.2 |
Immunogen: | HN1L (NP_653171.1, 1 a.a. ~ 190 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY |
Protein accession: | NP_653171.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HN1L expression in transfected 293T cell line (H00090861-T02) by HN1L MaxPab polyclonal antibody. Lane 1: HN1L transfected lysate(20.10 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |