Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HN1L MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about HN1L MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00090861-B01 |
| Product name: | HN1L MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human HN1L protein. |
| Gene id: | 90861 |
| Gene name: | HN1L |
| Gene alias: | C16orf34|FLJ13092|KIAA1426|L11 |
| Gene description: | hematological and neurological expressed 1-like |
| Genbank accession: | NM_144570.2 |
| Immunogen: | HN1L (NP_653171.1, 1 a.a. ~ 190 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY |
| Protein accession: | NP_653171.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HN1L expression in transfected 293T cell line (H00090861-T02) by HN1L MaxPab polyclonal antibody. Lane 1: HN1L transfected lysate(20.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |