ZNF598 polyclonal antibody (A01) View larger

ZNF598 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF598 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ZNF598 polyclonal antibody (A01)

Brand: Abnova
Reference: H00090850-A01
Product name: ZNF598 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ZNF598.
Gene id: 90850
Gene name: ZNF598
Gene alias: DKFZp762F135|FLJ00086
Gene description: zinc finger protein 598
Genbank accession: NM_178167
Immunogen: ZNF598 (NP_835461, 28 a.a. ~ 126 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATIPIHQLQHEKKYDIYFADGKVYALYRQLLQHECPRCPELP
Protein accession: NP_835461
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00090850-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00090850-A01-1-1-1.jpg
Application image note: ZNF598 polyclonal antibody (A01). Western Blot analysis of ZNF598 expression in HeLa.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF598 polyclonal antibody (A01) now

Add to cart