ZNF622 monoclonal antibody (M02), clone 3C5 View larger

ZNF622 monoclonal antibody (M02), clone 3C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF622 monoclonal antibody (M02), clone 3C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF622 monoclonal antibody (M02), clone 3C5

Brand: Abnova
Reference: H00090441-M02
Product name: ZNF622 monoclonal antibody (M02), clone 3C5
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF622.
Clone: 3C5
Isotype: IgG1 Kappa
Gene id: 90441
Gene name: ZNF622
Gene alias: MGC17552|MGC2485|ZPR9
Gene description: zinc finger protein 622
Genbank accession: NM_033414
Immunogen: ZNF622 (NP_219482, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQ
Protein accession: NP_219482
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00090441-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00090441-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ZNF622 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF622 monoclonal antibody (M02), clone 3C5 now

Add to cart