THRAP6 (Human) Recombinant Protein (P01) View larger

THRAP6 (Human) Recombinant Protein (P01)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of THRAP6 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about THRAP6 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00090390-P01
Product name: THRAP6 (Human) Recombinant Protein (P01)
Product description: Human THRAP6 full-length ORF ( AAH08226, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 90390
Gene name: MED30
Gene alias: MGC9890|THRAP6|TRAP25
Gene description: mediator complex subunit 30
Genbank accession: BC008226
Immunogen sequence/protein sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN
Protein accession: AAH08226
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00090390-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy THRAP6 (Human) Recombinant Protein (P01) now

Add to cart