CEACAM21 purified MaxPab mouse polyclonal antibody (B01P) View larger

CEACAM21 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CEACAM21 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CEACAM21 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00090273-B01P
Product name: CEACAM21 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CEACAM21 protein.
Gene id: 90273
Gene name: CEACAM21
Gene alias: CEACAM3|FLJ13540|MGC119874|R29124_1
Gene description: carcinoembryonic antigen-related cell adhesion molecule 21
Genbank accession: BC012001
Immunogen: CEACAM21 (AAH12001.1, 1 a.a. ~ 191 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQRRAPWS
Protein accession: AAH12001.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00090273-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CEACAM21 expression in transfected 293T cell line (H00090273-T01) by CEACAM21 MaxPab polyclonal antibody.

Lane 1: CEACAM21 transfected lysate(21.01 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CEACAM21 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart