RHOT2 polyclonal antibody (A01) View larger

RHOT2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHOT2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about RHOT2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00089941-A01
Product name: RHOT2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RHOT2.
Gene id: 89941
Gene name: RHOT2
Gene alias: ARHT2|C16orf39|MIRO-2|RASL
Gene description: ras homolog gene family, member T2
Genbank accession: NM_138769
Immunogen: RHOT2 (NP_620124, 385 a.a. ~ 486 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: YPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATC
Protein accession: NP_620124
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00089941-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00089941-A01-1-22-1.jpg
Application image note: RHOT2 polyclonal antibody (A01), Lot # 050926JC01 Western Blot analysis of RHOT2 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RHOT2 polyclonal antibody (A01) now

Add to cart