NAV2 monoclonal antibody (M01), clone 4D11 View larger

NAV2 monoclonal antibody (M01), clone 4D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAV2 monoclonal antibody (M01), clone 4D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NAV2 monoclonal antibody (M01), clone 4D11

Brand: Abnova
Reference: H00089797-M01
Product name: NAV2 monoclonal antibody (M01), clone 4D11
Product description: Mouse monoclonal antibody raised against a partial recombinant NAV2.
Clone: 4D11
Isotype: IgG2a Kappa
Gene id: 89797
Gene name: NAV2
Gene alias: FLJ10633|FLJ11030|FLJ23707|FLJ77876|HELAD1|KIAA1419|POMFIL2|RAINB1|STEERIN2|UNC53H2
Gene description: neuron navigator 2
Genbank accession: NM_182964
Immunogen: NAV2 (NP_892009.2, 1878 a.a. ~ 1973 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVS
Protein accession: NP_892009.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00089797-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00089797-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NAV2 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NAV2 monoclonal antibody (M01), clone 4D11 now

Add to cart