Brand: | Abnova |
Reference: | H00089797-M01 |
Product name: | NAV2 monoclonal antibody (M01), clone 4D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NAV2. |
Clone: | 4D11 |
Isotype: | IgG2a Kappa |
Gene id: | 89797 |
Gene name: | NAV2 |
Gene alias: | FLJ10633|FLJ11030|FLJ23707|FLJ77876|HELAD1|KIAA1419|POMFIL2|RAINB1|STEERIN2|UNC53H2 |
Gene description: | neuron navigator 2 |
Genbank accession: | NM_182964 |
Immunogen: | NAV2 (NP_892009.2, 1878 a.a. ~ 1973 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVS |
Protein accession: | NP_892009.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NAV2 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |