Brand: | Abnova |
Reference: | H00089790-A01 |
Product name: | SIGLEC10 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SIGLEC10. |
Gene id: | 89790 |
Gene name: | SIGLEC10 |
Gene alias: | MGC126774|PRO940|SIGLEC-10|SLG2 |
Gene description: | sialic acid binding Ig-like lectin 10 |
Genbank accession: | NM_033130 |
Immunogen: | SIGLEC10 (NP_149121, 589 a.a. ~ 696 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKF |
Protein accession: | NP_149121 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SIGLEC10 polyclonal antibody (A01), Lot # O51123JC01 Western Blot analysis of SIGLEC10 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |