Product successfully added to your shopping cart
Quantity
Total
There are 85 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 32 204,28 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 32 204,28 €
Data sheet of CCNB3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about CCNB3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00085417-D01P |
| Product name: | CCNB3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CCNB3 protein. |
| Gene id: | 85417 |
| Gene name: | CCNB3 |
| Gene alias: | - |
| Gene description: | cyclin B3 |
| Genbank accession: | ENST00000376036 |
| Immunogen: | CCNB3 (ENSP00000365204, 1 a.a. ~ 111 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESPSSLQGALKKRSAFEDLTNASQCQPVQPKKEANKEFVKVVSKKINRNTHALGLAKKNKRNLK |
| Protein accession: | ENSP00000365204 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CCNB3 expression in transfected 293T cell line (H00085417-T02) by CCNB3 MaxPab polyclonal antibody. Lane 1: CCNB3 transfected lysate(12.20 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |