Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ALG2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,WB-Tr |
More info about ALG2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00085365-D01P |
| Product name: | ALG2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ALG2 protein. |
| Gene id: | 85365 |
| Gene name: | ALG2 |
| Gene alias: | CDGIi|FLJ14511|hALPG2 |
| Gene description: | asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae) |
| Genbank accession: | NM_033087.3 |
| Immunogen: | ALG2 (NP_149078.1, 1 a.a. ~ 416 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSACIPVFRLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV |
| Protein accession: | NP_149078.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ALG2 expression in transfected 293T cell line (H00085365-T01) by ALG2 MaxPab polyclonal antibody. Lane 1: ALG2 transfected lysate(47.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | A microtubule-associated protein MAP1B binds to and regulates localization of a calcium-binding protein ALG-2.Takahara T, Arai Y, Kono Y, Shibata H, Maki M. Biochem Biophys Res Commun. 2018 Mar 4;497(2):492-498. doi: 10.1016/j.bbrc.2018.02.048. Epub 2018 Feb 10. |