TRIM5 monoclonal antibody (M06), clone 2A6 View larger

TRIM5 monoclonal antibody (M06), clone 2A6

H00085363-M06_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM5 monoclonal antibody (M06), clone 2A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about TRIM5 monoclonal antibody (M06), clone 2A6

Brand: Abnova
Reference: H00085363-M06
Product name: TRIM5 monoclonal antibody (M06), clone 2A6
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIM5.
Clone: 2A6
Isotype: IgG2a Kappa
Gene id: 85363
Gene name: TRIM5
Gene alias: RNF88|TRIM5alpha
Gene description: tripartite motif-containing 5
Genbank accession: NM_033034
Immunogen: TRIM5 (NP_149023, 309 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSF
Protein accession: NP_149023
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy TRIM5 monoclonal antibody (M06), clone 2A6 now

Add to cart