Cart 64 Product Products 26 327,82 € (empty)
No products
To be determined Shipping
26 327,82 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 64 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 26 327,82 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 26 327,82 €
Data sheet of LGALS12 purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about LGALS12 purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00085329-B02P |
| Product name: | LGALS12 purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human LGALS12 protein. |
| Gene id: | 85329 |
| Gene name: | LGALS12 |
| Gene alias: | GALECTIN-12|GRIP1 |
| Gene description: | lectin, galactoside-binding, soluble, 12 |
| Genbank accession: | NM_033101.2 |
| Immunogen: | LGALS12 (NP_149092.2, 1 a.a. ~ 336 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKLALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS |
| Protein accession: | NP_149092.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of LGALS12 expression in transfected 293T cell line (H00085329-T02) by LGALS12 MaxPab polyclonal antibody. Lane 1: LGALS12 transfected lysate(37.50 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |