Brand: | Abnova |
Reference: | H00085320-M02 |
Product name: | ABCC11 monoclonal antibody (M02), clone 4H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCC11. |
Clone: | 4H6 |
Isotype: | IgG2a Kappa |
Gene id: | 85320 |
Gene name: | ABCC11 |
Gene alias: | EWWD|MRP8|WW |
Gene description: | ATP-binding cassette, sub-family C (CFTR/MRP), member 11 |
Genbank accession: | NM_032583 |
Immunogen: | ABCC11 (NP_115972.2, 433 a.a. ~ 532 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINL |
Protein accession: | NP_115972.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ABCC11 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Salinomycin overcomes ABC transporter-mediated multidrug and apoptosis resistance in human leukemia stem cell-like KG-1a cells.Fuchs D, Daniel V, Sadeghi M, Opelz G, Naujokat C. Biochem Biophys Res Commun. 2010 Mar 27. [Epub ahead of print] |