PPIL4 monoclonal antibody (M01), clone 1C10 View larger

PPIL4 monoclonal antibody (M01), clone 1C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPIL4 monoclonal antibody (M01), clone 1C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about PPIL4 monoclonal antibody (M01), clone 1C10

Brand: Abnova
Reference: H00085313-M01
Product name: PPIL4 monoclonal antibody (M01), clone 1C10
Product description: Mouse monoclonal antibody raised against a partial recombinant PPIL4.
Clone: 1C10
Isotype: IgG2a Kappa
Gene id: 85313
Gene name: PPIL4
Gene alias: HDCME13P
Gene description: peptidylprolyl isomerase (cyclophilin)-like 4
Genbank accession: NM_139126
Immunogen: PPIL4 (NP_624311, 395 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLY
Protein accession: NP_624311
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00085313-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.66 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00085313-M01-1-25-1.jpg
Application image note: PPIL4 monoclonal antibody (M01), clone 1C10 Western Blot analysis of PPIL4 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy PPIL4 monoclonal antibody (M01), clone 1C10 now

Add to cart