Brand: | Abnova |
Reference: | H00085313-M01 |
Product name: | PPIL4 monoclonal antibody (M01), clone 1C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PPIL4. |
Clone: | 1C10 |
Isotype: | IgG2a Kappa |
Gene id: | 85313 |
Gene name: | PPIL4 |
Gene alias: | HDCME13P |
Gene description: | peptidylprolyl isomerase (cyclophilin)-like 4 |
Genbank accession: | NM_139126 |
Immunogen: | PPIL4 (NP_624311, 395 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLY |
Protein accession: | NP_624311 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PPIL4 monoclonal antibody (M01), clone 1C10 Western Blot analysis of PPIL4 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |