Brand: | Abnova |
Reference: | H00085300-M07 |
Product name: | ATCAY monoclonal antibody (M07), clone 4F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATCAY. |
Clone: | 4F2 |
Isotype: | IgG1 Kappa |
Gene id: | 85300 |
Gene name: | ATCAY |
Gene alias: | BNIP-H|CLAC|KIAA1872 |
Gene description: | ataxia, cerebellar, Cayman type |
Genbank accession: | NM_033064 |
Immunogen: | ATCAY (NP_149053.1, 3 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEI |
Protein accession: | NP_149053.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ATCAY monoclonal antibody (M07), clone 4F2. Western Blot analysis of ATCAY expression in IMR-32(Cat # L008V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |