Brand: | Abnova |
Reference: | H00085015-M01 |
Product name: | USP45 monoclonal antibody (M01), clone 1H2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant USP45. |
Clone: | 1H2 |
Isotype: | IgG2a Kappa |
Gene id: | 85015 |
Gene name: | USP45 |
Gene alias: | MGC14793 |
Gene description: | ubiquitin specific peptidase 45 |
Genbank accession: | XM_371838 |
Immunogen: | USP45 (XP_371838, 106 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FKSSRTEPHCIIINLSTWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQKGGKCRNLSVRGITNLG |
Protein accession: | XP_371838 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | USP45 monoclonal antibody (M01), clone 1H2. Western Blot analysis of USP45 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |