Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TCEAL3 monoclonal antibody (M05), clone 4F3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about TCEAL3 monoclonal antibody (M05), clone 4F3
| Brand: | Abnova |
| Reference: | H00085012-M05 |
| Product name: | TCEAL3 monoclonal antibody (M05), clone 4F3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant TCEAL3. |
| Clone: | 4F3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 85012 |
| Gene name: | TCEAL3 |
| Gene alias: | MGC15737 |
| Gene description: | transcription elongation factor A (SII)-like 3 |
| Genbank accession: | NM_001006933.1 |
| Immunogen: | TCEAL3 (NP_001006934.1, 1 a.a. ~ 200 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQLEDEGSQEKQGRSEGEGKPQGEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL |
| Protein accession: | NP_001006934.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (48.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TCEAL3 is 0.1 ng/ml as a capture antibody. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |