Brand: | Abnova |
Reference: | H00085012-M05 |
Product name: | TCEAL3 monoclonal antibody (M05), clone 4F3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant TCEAL3. |
Clone: | 4F3 |
Isotype: | IgG2a Kappa |
Gene id: | 85012 |
Gene name: | TCEAL3 |
Gene alias: | MGC15737 |
Gene description: | transcription elongation factor A (SII)-like 3 |
Genbank accession: | NM_001006933.1 |
Immunogen: | TCEAL3 (NP_001006934.1, 1 a.a. ~ 200 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQLEDEGSQEKQGRSEGEGKPQGEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL |
Protein accession: | NP_001006934.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (48.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TCEAL3 is 0.1 ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |