PPP1R16A monoclonal antibody (M06), clone 2B12 View larger

PPP1R16A monoclonal antibody (M06), clone 2B12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP1R16A monoclonal antibody (M06), clone 2B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PPP1R16A monoclonal antibody (M06), clone 2B12

Brand: Abnova
Reference: H00084988-M06
Product name: PPP1R16A monoclonal antibody (M06), clone 2B12
Product description: Mouse monoclonal antibody raised against a partial recombinant PPP1R16A.
Clone: 2B12
Isotype: IgG2a Kappa
Gene id: 84988
Gene name: PPP1R16A
Gene alias: MGC14333|MYPT3
Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 16A
Genbank accession: NM_032902
Immunogen: PPP1R16A (NP_116291.1, 429 a.a. ~ 528 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDTVTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM
Protein accession: NP_116291.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084988-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084988-M06-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged PPP1R16A is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PPP1R16A monoclonal antibody (M06), clone 2B12 now

Add to cart