Brand: | Abnova |
Reference: | H00084959-M01 |
Product name: | UBASH3B monoclonal antibody (M01), clone 3G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBASH3B. |
Clone: | 3G7 |
Isotype: | IgG2b Kappa |
Gene id: | 84959 |
Gene name: | UBASH3B |
Gene alias: | KIAA1959|MGC15437|STS-1|STS1|p70 |
Gene description: | ubiquitin associated and SH3 domain containing, B |
Genbank accession: | NM_032873 |
Immunogen: | UBASH3B (NP_116262.2, 344 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPI |
Protein accession: | NP_116262.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to UBASH3B on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |