Brand: | Abnova |
Reference: | H00084957-M01 |
Product name: | TNFRSF19L monoclonal antibody (M01), clone 3F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF19L. |
Clone: | 3F8 |
Isotype: | IgG2a Kappa |
Gene id: | 84957 |
Gene name: | RELT |
Gene alias: | FLJ14993|TNFRSF19L |
Gene description: | RELT tumor necrosis factor receptor |
Genbank accession: | NM_032871 |
Immunogen: | TNFRSF19L (NP_116260, 26 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEW |
Protein accession: | NP_116260 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Western blot analysis of TNFRSF19L over-expressed 293 cell line, cotransfected with TNFRSF19L Validated Chimera RNAi ( Cat # H00084957-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TNFRSF19L monoclonal antibody (M01), clone 3F8 (Cat # H00084957-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |