TNFRSF19L polyclonal antibody (A01) View larger

TNFRSF19L polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFRSF19L polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about TNFRSF19L polyclonal antibody (A01)

Brand: Abnova
Reference: H00084957-A01
Product name: TNFRSF19L polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TNFRSF19L.
Gene id: 84957
Gene name: RELT
Gene alias: FLJ14993|TNFRSF19L
Gene description: RELT tumor necrosis factor receptor
Genbank accession: NM_032871
Immunogen: TNFRSF19L (NP_116260, 26 a.a. ~ 124 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEW
Protein accession: NP_116260
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084957-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084957-A01-1-2-1.jpg
Application image note: TNFRSF19L polyclonal antibody (A01), Lot # 051123JC01 Western Blot analysis of TNFRSF19L expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNFRSF19L polyclonal antibody (A01) now

Add to cart