ZFYVE19 MaxPab mouse polyclonal antibody (B01) View larger

ZFYVE19 MaxPab mouse polyclonal antibody (B01)

H00084936-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZFYVE19 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about ZFYVE19 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00084936-B01
Product name: ZFYVE19 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ZFYVE19 protein.
Gene id: 84936
Gene name: ZFYVE19
Gene alias: FLJ14840|MPFYVE
Gene description: zinc finger, FYVE domain containing 19
Genbank accession: BC021092.1
Immunogen: ZFYVE19 (AAH21092.1, 1 a.a. ~ 328 a.a) full-length human protein.
Immunogen sequence/protein sequence: MESRCYGCAVKFTLFKKEYGCKNCGRAFRSGCLSFSAAVPRTGNTQQKVCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPVTLQDYRLPDSDDDEDEETAIQRVLQQLTEEAALDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH
Protein accession: AAH21092.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084936-B01-13-15-1.jpg
Application image note: Western Blot analysis of ZFYVE19 expression in transfected 293T cell line (H00084936-T01) by ZFYVE19 MaxPab polyclonal antibody.

Lane 1: ZFYVE19 transfected lysate(36.08 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZFYVE19 MaxPab mouse polyclonal antibody (B01) now

Add to cart