Product successfully added to your shopping cart
Quantity
Total
There are 99 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 38 416,42 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 38 416,42 €
Data sheet of C8orf76 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about C8orf76 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00084933-B01P |
| Product name: | C8orf76 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human C8orf76 protein. |
| Gene id: | 84933 |
| Gene name: | C8orf76 |
| Gene alias: | FLJ14825|MGC9784 |
| Gene description: | chromosome 8 open reading frame 76 |
| Genbank accession: | NM_032847 |
| Immunogen: | C8orf76 (NP_116236, 1 a.a. ~ 380 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDSGCWLFGGEFEDSVFEERPERRSGPPASYCAKLCEPQWFYEETESSDDVEVLTLKKFKGDLAYRRQEYQKALQEYSSISEKLSSTNFAMKRDVQEGQARCLAHLGRHMEALEIAANLENKATNTDHLTTVLYLQLAICSSLQNLEKTIFCLQKLISLHPFNPWNWGKLAEAYLNLGPALSAALASSQKQHSFTSSDKTIKSFFPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQTSFALERNLRTQQEIEDKMKGFSFKEDTLLLIAEVMGEDIPEKIKDEVHPEVKCVGSVALTALVTVSSEEFEDKWFRKIKDHFCPFENQFHTEIQILA |
| Protein accession: | NP_116236 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of C8orf76 expression in transfected 293T cell line by C8orf76 MaxPab polyclonal antibody. Lane 1: C8orf76 transfected lysate(41.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |