NFATC2IP purified MaxPab rabbit polyclonal antibody (D01P) View larger

NFATC2IP purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NFATC2IP purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIF,WB-Tr

More info about NFATC2IP purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00084901-D01P
Product name: NFATC2IP purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human NFATC2IP protein.
Gene id: 84901
Gene name: NFATC2IP
Gene alias: FLJ14639|MGC126790|MGC138387
Gene description: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein
Genbank accession: BC021551
Immunogen: NFATC2IP (AAH21551.1, 1 a.a. ~ 138 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
Protein accession: AAH21551.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00084901-D01P-13-15-1.jpg
Application image note: Western Blot analysis of NFATC2IP expression in transfected 293T cell line (H00084901-T02) by NFATC2IP MaxPab polyclonal antibody.

Lane 1: NFATC2IP transfected lysate(15.10 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NFATC2IP purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart