Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FSHB polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | ELISA,IHC,Dot |
More info about FSHB polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB8953 |
| Product name: | FSHB polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against synthetic peptide of FSHB. |
| Gene id: | 2488 |
| Gene name: | FSHB |
| Gene alias: | - |
| Gene description: | follicle stimulating hormone, beta polypeptide |
| Immunogen: | A synthetic peptide corresponding to amino acids 47-84 of human FSHB. |
| Immunogen sequence/protein sequence: | IQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCH |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:250) ELISA (1:50000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In buffer containing 0.02% sodium azide |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Synthetic Peptide. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Applications: | ELISA,IHC,Dot |
| Shipping condition: | Dry Ice |
| Publications: | Role of carbohydrates in glycoprotein hormone signal transduction.Sairam MR. FASEB J. 1989 Jun;3(8):1915-26. |