Brand: | Abnova |
Reference: | PAB4978 |
Product name: | NPPC polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against synthetic peptide of NPPC. |
Gene id: | 4880 |
Gene name: | NPPC |
Gene alias: | CNP |
Gene description: | natriuretic peptide precursor C |
Immunogen: | A synthetic peptide (conjugated with KLH) corresponding to human NPPC. |
Immunogen sequence/protein sequence: | DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC |
Form: | Liquid |
Recommend dilutions: | The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal) |
Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against synthetic peptide. |
Note: | This product contains thimerosal: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | IP,EIA |
Shipping condition: | Dry Ice |