Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IHC-P |
Brand: | Abnova |
Reference: | PAB31046 |
Product name: | GSTA3 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombiant human GSTA3. |
Isotype: | IgG |
Gene id: | 2940 |
Gene name: | GSTA3 |
Gene alias: | GSTA3-3|GTA3|MGC22232 |
Gene description: | glutathione S-transferase alpha 3 |
Immunogen: | Recombinant protein corresponding to human GSTA3. |
Immunogen sequence/protein sequence: | GKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDY |
Protein accession: | Q16772 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50) Western Blot (1:100-250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of (1) Human RT-4 cell, (2) Human U-251MG sp cell, (3) Human A-431 cell, (4) Human liver tissue, (5) Human tonsil tissue. |
Applications: | WB,IHC-P |
Shipping condition: | Dry Ice |