LAMB1 polyclonal antibody View larger

LAMB1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LAMB1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about LAMB1 polyclonal antibody

Brand: Abnova
Reference: PAB31029
Product name: LAMB1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombiant human LAMB1.
Isotype: IgG
Gene id: 3912
Gene name: LAMB1
Gene alias: CLM|MGC142015
Gene description: laminin, beta 1
Immunogen: Recombinant protein corresponding to human LAMB1.
Immunogen sequence/protein sequence: GPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEF
Protein accession: P07942
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: PAB31029-46-multi-1.jpg
Application image note: Western Blot (Cell lysate) analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy LAMB1 polyclonal antibody now

Add to cart