TST polyclonal antibody View larger

TST polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TST polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,IHC-P

More info about TST polyclonal antibody

Brand: Abnova
Reference: PAB31012
Product name: TST polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombiant human TST.
Isotype: IgG
Gene id: 7263
Gene name: TST
Gene alias: MGC19578|RDS
Gene description: thiosulfate sulfurtransferase (rhodanese)
Immunogen: Recombinant protein corresponding to human TST.
Immunogen sequence/protein sequence: VHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRDTASPYEMMLPSEAGFAEYVGRLGISNHTHVVVYDGEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPS
Protein accession: Q16762
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31012-47-8-1.jpg
Application image note: Western Blot (Tissue lysate) analysis of human liver.
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy TST polyclonal antibody now

Add to cart