Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB31011 |
Product name: | ICT1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombiant human ICT1. |
Isotype: | IgG |
Gene id: | 3396 |
Gene name: | ICT1 |
Gene alias: | DS-1 |
Gene description: | immature colon carcinoma transcript 1 |
Immunogen: | Recombinant protein corresponding to human ICT1. |
Immunogen sequence/protein sequence: | TEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMI |
Protein accession: | Q14197 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200) Western Blot (1:100-250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Western Blot (Cell lysate) analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells). |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |