Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IHC-P |
Brand: | Abnova |
Reference: | PAB31007 |
Product name: | UQCRC1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombiant human UQCRC1. |
Isotype: | IgG |
Gene id: | 7384 |
Gene name: | UQCRC1 |
Gene alias: | D3S3191|QCR1|UQCR1 |
Gene description: | ubiquinol-cytochrome c reductase core protein I |
Immunogen: | Recombinant protein corresponding to human UQCRC1. |
Immunogen sequence/protein sequence: | DDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVCDRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGR |
Protein accession: | P31930 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500) Western Blot (1:100-250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of (1) Human RT-4 cell, (2) Human U-251MG sp cell, (3) Human A-431 cell, (4) Human liver tissue, (5) Human tonsil tissue. |
Applications: | WB,IHC-P |
Shipping condition: | Dry Ice |