Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ITGA5 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about ITGA5 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31001 |
| Product name: | ITGA5 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human ITGA5. |
| Isotype: | IgG |
| Gene id: | 3678 |
| Gene name: | ITGA5 |
| Gene alias: | CD49e|FNRA|VLA5A |
| Gene description: | integrin, alpha 5 (fibronectin receptor, alpha polypeptide) |
| Immunogen: | Recombinant protein corresponding to human ITGA5. |
| Immunogen sequence/protein sequence: | DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA |
| Protein accession: | P08648 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of Lane 1: mouse NIH-3T3, Lane 2: rat NBT-II and Lane 3: rat PC12 cell lysates with ITGA5 polyclonal antibody (Cat # PAB31001). |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Survivin promotion of melanoma metastasis requires upregulation of α5 integrin.McKenzie JA, Liu T, Jung JY, Jones BB, Ekiz HA, Welm AL, Grossman D. Carcinogenesis. 2013 Sep;34(9):2137-44. doi: 10.1093/carcin/bgt155. Epub 2013 May 2. |