MATN1 polyclonal antibody View larger

MATN1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MATN1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about MATN1 polyclonal antibody

Brand: Abnova
Reference: PAB30991
Product name: MATN1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human MATN1.
Isotype: IgG
Gene id: 4146
Gene name: MATN1
Gene alias: CMP|CRTM
Gene description: matrilin 1, cartilage matrix protein
Immunogen: Recombinant protein corresponding to human MATN1.
Immunogen sequence/protein sequence: REIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV
Protein accession: P21941
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30991-48-43-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skeletal muscle with MATN1 polyclonal antibody (Cat # PAB30991) shows moderate cytoplasmic positivity in myocytes.
Applications: IHC-P
Shipping condition: Dry Ice
Publications: Loss of matrilin 1 does not exacerbate the skeletal phenotype in a mouse model of multiple epiphyseal dysplasia caused by a Matn3 V194D mutation.Bell PA, Pirog KA, Fresquet M, Thornton DJ, Boot-Handford RP, Briggs MD.
Arthritis Rheum. 2012 May;64(5):1529-39. doi: 10.1002/art.33486.

Reviews

Buy MATN1 polyclonal antibody now

Add to cart