GRB10 polyclonal antibody View larger

GRB10 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRB10 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about GRB10 polyclonal antibody

Brand: Abnova
Reference: PAB30979
Product name: GRB10 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human GRB10.
Isotype: IgG
Gene id: 2887
Gene name: GRB10
Gene alias: GRB-IR|Grb-10|IRBP|KIAA0207|MEG1|RSS
Gene description: growth factor receptor-bound protein 10
Immunogen: Recombinant protein corresponding to human GRB10.
Immunogen sequence/protein sequence: FSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDG
Protein accession: Q13322
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30979-48-2-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with GRB10 polyclonal antibody (Cat # PAB30979) shows strong cytoplasmic and membranous positivity in cells in tubules.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy GRB10 polyclonal antibody now

Add to cart