MRPL41 polyclonal antibody View larger

MRPL41 polyclonal antibody

PAB30971_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRPL41 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about MRPL41 polyclonal antibody

Brand: Abnova
Reference: PAB30971
Product name: MRPL41 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human MRPL41.
Isotype: IgG
Gene id: 64975
Gene name: MRPL41
Gene alias: BMRP|MRP-L27|MRPL27|PIG3|RPML27
Gene description: mitochondrial ribosomal protein L41
Immunogen: Recombinant protein corresponding to human MRPL41.
Immunogen sequence/protein sequence: GADRMSKWTSKRGPRSFRGRKGRGAKGIGFLTSGWRFVQIKEMVPEFVVPDLTGFKL
Protein accession: Q8IXM3
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30971-48-258-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human rectum with MRPL41 polyclonal antibody (Cat # PAB30971) shows strong positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy MRPL41 polyclonal antibody now

Add to cart