AGBL3 polyclonal antibody View larger

AGBL3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AGBL3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about AGBL3 polyclonal antibody

Brand: Abnova
Reference: PAB30943
Product name: AGBL3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human AGBL3.
Isotype: IgG
Gene id: 340351
Gene name: AGBL3
Gene alias: FLJ12983|MGC32955
Gene description: ATP/GTP binding protein-like 3
Immunogen: Recombinant protein corresponding to human AGBL3.
Immunogen sequence/protein sequence: DYSDRTISDEDESDEDMFMKFVSEDLHRCALLTADSFGDPFFPRTTQILLEYQLGRWVPRLREPRDLYGVSSSGPLSPTRWPYHCEVIDE
Protein accession: Q8NEM8
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30943-48-38-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with AGBL3 polyclonal antibody (Cat # PAB30943) shows strong cytoplasmic positivity in exocrine glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy AGBL3 polyclonal antibody now

Add to cart