Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLIT2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about SLIT2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30933 |
| Product name: | SLIT2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human SLIT2. |
| Isotype: | IgG |
| Gene id: | 9353 |
| Gene name: | SLIT2 |
| Gene alias: | FLJ14420|SLIL3|Slit-2 |
| Gene description: | slit homolog 2 (Drosophila) |
| Immunogen: | Recombinant protein corresponding to human SLIT2. |
| Immunogen sequence/protein sequence: | LYINSELQDFQKVPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLE |
| Protein accession: | O94813 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with SLIT2 polyclonal antibody (Cat # PAB30933) shows strong cytoplasmic and membranous positivity in glandular cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Loss of expression and promoter methylation of SLIT2 are associated with sessile serrated adenoma formation.Beggs AD, Jones A, Shepherd N, Arnaout A, Finlayson C, Abulafi AM, Morton DG, Matthews GM, Hodgson SV, Tomlinson IP. PLoS Genet. 2013 May;9(5):e1003488. doi: 10.1371/journal.pgen.1003488. Epub 2013 May 9. |