Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLG polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about PLG polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30924 |
| Product name: | PLG polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human PLG. |
| Isotype: | IgG |
| Gene id: | 5340 |
| Gene name: | PLG |
| Gene alias: | DKFZp779M0222 |
| Gene description: | plasminogen |
| Immunogen: | Recombinant protein corresponding to human PLG. |
| Immunogen sequence/protein sequence: | NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE |
| Protein accession: | P00747 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with PLG polyclonal antibody (Cat # PAB30924) shows positivity in plasma. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen.Grundel A, Friedrich K, Pfeiffer M, Jacobs E, Dumke R. PLoS One. 2015 May 15;10(5):e0126600. doi: 10.1371/journal.pone.0126600. eCollection 2015. |