MGAT3 polyclonal antibody View larger

MGAT3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGAT3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about MGAT3 polyclonal antibody

Brand: Abnova
Reference: PAB30892
Product name: MGAT3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human MGAT3.
Isotype: IgG
Gene id: 4248
Gene name: MGAT3
Gene alias: FLJ43371|GNT-III|GNT3|MGC141943|MGC142278
Gene description: mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
Immunogen: Recombinant protein corresponding to human MGAT3.
Immunogen sequence/protein sequence: RRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVINAINVNHEFDLLDVRFHELGDVVDAFVVCESNFTAYG
Protein accession: Q09327
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30892-48-43-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skeletal muscle with MGAT3 polyclonal antibody (Cat # PAB30892) shows strong cytoplasmic positivity in myocytes.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy MGAT3 polyclonal antibody now

Add to cart