Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CHGA polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about CHGA polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30890 |
| Product name: | CHGA polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human CHGA. |
| Isotype: | IgG |
| Gene id: | 1113 |
| Gene name: | CHGA |
| Gene alias: | CGA |
| Gene description: | chromogranin A (parathyroid secretory protein 1) |
| Immunogen: | Recombinant protein corresponding to human CHGA. |
| Immunogen sequence/protein sequence: | NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK |
| Protein accession: | P10645 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human rectum with CHGA polyclonal antibody (Cat # PAB30890) shows strong cytoplasmic positivity in subset of glandular cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Identification of a gene regulatory network associated with prion replication.Marbiah MM, Harvey A, West BT, Louzolo A, Banerjee P, Alden J, Grigoriadis A, Hummerich H, Kan HM, Cai Y, Bloom GS, Jat P, Collinge J, Klohn PC. EMBO J. 2014 Jul 17;33(14):1527-47. doi: 10.15252/embj.201387150. Epub 2014 May 19. |