DYSF polyclonal antibody View larger

DYSF polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DYSF polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about DYSF polyclonal antibody

Brand: Abnova
Reference: PAB30887
Product name: DYSF polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human DYSF.
Isotype: IgG
Gene id: 8291
Gene name: DYSF
Gene alias: FER1L1|FLJ00175|FLJ90168|LGMD2B
Gene description: dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive)
Immunogen: Recombinant protein corresponding to human DYSF.
Immunogen sequence/protein sequence: IVVELYDHDTYGADEFMGRCICQPSLERMPRLAWFPLTRGSQPSGELLASFELIQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWG
Protein accession: O75923
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30887-48-43-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skeletal muscle with DYSF polyclonal antibody (Cat # PAB30887) shows strong cytoplasmic positivity in myocytes.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy DYSF polyclonal antibody now

Add to cart