KCNQ2 polyclonal antibody View larger

KCNQ2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCNQ2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about KCNQ2 polyclonal antibody

Brand: Abnova
Reference: PAB30882
Product name: KCNQ2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human KCNQ2.
Isotype: IgG
Gene id: 3785
Gene name: KCNQ2
Gene alias: BFNC|EBN|EBN1|ENB1|HNSPC|KCNA11|KV7.2|KVEBN1
Gene description: potassium voltage-gated channel, KQT-like subfamily, member 2
Immunogen: Recombinant protein corresponding to human KCNQ2.
Immunogen sequence/protein sequence: FYATNLSRTDLHSTWQYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLAFRKDPPPEPSPSQKVSLKDRVFSSPRGVAAKGKGSPQAQTVRRSPSADQSLEDSPSKVPKSWSFGDRSRARQAFRIKGAASRQNSEEA
Protein accession: O43526
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30882-48-52-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with KCNQ2 polyclonal antibody (Cat # PAB30882) shows moderate nuclear membranous positivity in Purkinje cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy KCNQ2 polyclonal antibody now

Add to cart